Package: softwareRisk 0.2.0
softwareRisk: Computation of Node and Path-Level Risk Scores in Scientific Models
It leverages the network-like architecture of scientific models together with software quality metrics to identify chains of function calls that are more prone to generating and propagating errors. It operates on tbl_graph objects representing call dependencies between functions (callers and callees) and computes risk scores for individual functions and for paths (sequences of function calls) based on cyclomatic complexity, in-degree and betweenness centrality. The package supports variance-based uncertainty and sensitivity analyses after Puy et al. (2022) <doi:10.18637/jss.v102.i05> to assess how risk scores change under alternative risk definitions.
Authors:
softwareRisk_0.2.0.tar.gz
softwareRisk_0.2.0.zip(r-4.7)softwareRisk_0.2.0.zip(r-4.6)softwareRisk_0.2.0.zip(r-4.5)
softwareRisk_0.2.0.tgz(r-4.6-any)softwareRisk_0.2.0.tgz(r-4.5-any)
softwareRisk_0.2.0.tar.gz(r-4.7-any)softwareRisk_0.2.0.tar.gz(r-4.6-any)
softwareRisk_0.2.0.tgz(r-4.6-emscripten)
manual.pdf |manual.html✨
DESCRIPTION |NEWS
card.svg |card.png
softwareRisk/json (API)
| # Install 'softwareRisk' in R: |
| install.packages('softwareRisk', repos = c('https://arnaldpuy.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/arnaldpuy/softwarerisk/issues
- synthetic_graph - Synthetic citation graph for software risk examples
Last updated from:bf68f0b0eb. Checks:9 OK. Indexed: yes.
| Target | Result | Time | Files | Syslog |
|---|---|---|---|---|
| linux-devel-x86_64 | OK | 170 | ||
| source / vignettes | OK | 216 | ||
| linux-release-x86_64 | OK | 167 | ||
| macos-release-arm64 | OK | 130 | ||
| macos-oldrel-arm64 | OK | 90 | ||
| windows-devel | OK | 123 | ||
| windows-release | OK | 108 | ||
| windows-oldrel | OK | 89 | ||
| wasm-release | OK | 121 |
Exports:all_paths_fungini_index_funpath_fix_heatmappath_uncertainty_plotplot_top_paths_funslope_funtheme_APuncertainty_fun
Dependencies:base64encbootcachemclicpp11data.tabledeSolvedplyrfarverfastmapgenericsggforceggplot2ggraphggrepelgluegraphlayoutsgridExtragtableigraphineqisobandjsonlitelabelinglatticelhslifecyclemagrittrMASSMatrixmatrixStatsmemoisepillarpkgconfigpolyclippurrrR6randtoolboxrbibutilsRColorBrewerRcppRcppArmadilloRcppParallelRdpackRfastrlangrngWELLS7scalessensobolstringistringrsystemfontstibbletidygraphtidyrtidyselecttweenrutf8vctrsviridisviridisLitewithrzigg
Readme and manuals
Help Manual
| Help page | Topics |
|---|---|
| Enumerate entry-to-sink call paths and compute risk metrics at the node and path level | all_paths_fun |
| Compute the Gini index of a numeric vector | gini_index_fun |
| Path-level improvement from fixing high-risk nodes | path_fix_heatmap |
| Plot path-level uncertainty for the top-risk paths | path_uncertainty_plot |
| Plot the top risky call paths on a Sugiyama layout | plot_top_paths_fun |
| Compute the linear slope of a numeric sequence | slope_fun |
| Synthetic citation graph for software risk examples | synthetic_graph |
| A clean, publication-oriented ggplot2 theme | theme_AP |
| Uncertainty and sensitivity analysis of node and path risk | uncertainty_fun |
